Buy IGF-1 LR3 Online – High Purity IGF-1 LR3 Peptide for Research Use

Name: Buy IGF-1 LR3 online | IGF-1 LR3 for Sale | Where to Buy IGF-1 LR3 Online
Price: 64.00 USD
Availability: InStock

Are you searching for premium-quality IGF-1 LR3 for your laboratory research? Look no further than Anabolic Steroid Shop, your trusted source to buy IGF-1 LR3 online. Our high-purity Long R3 IGF-1 peptide is manufactured under strict quality control standards, ensuring consistent results for your research applications. When you buy IGF-1 LR3 online from us, you’re investing in laboratory-tested peptides backed by comprehensive documentation and exceptional customer service.

buy IGF-1 LR3 online

What Is IGF-1 LR3?

IGF-1 LR3 (Long R3 Insulin-like Growth Factor-1) is a modified recombinant peptide that represents an enhanced version of human insulin-like growth factor 1 (IGF-1). This research peptide consists of 83 amino acids, including a 13-amino acid extension at the N-terminus and an arginine substitution at position 3, giving it the “Long R3” designation.

When researchers buy IGF-1 LR3 online for their studies, they’re acquiring a compound specifically engineered to have reduced binding to IGF binding proteins, resulting in significantly extended half-life and enhanced potency compared to native IGF-1 in laboratory settings.

As a synthetic analog of IGF-1, Long R3 IGF-1 has gained significant attention in scientific communities for its potential applications in various research models. When you buy IGF-1 LR3 online, you’re obtaining a peptide that has been studied for its ability to promote cellular growth and metabolism with greater efficiency than standard IGF-1. While native IGF-1 typically has a half-life of just 12-15 minutes in research models, IGF-1 LR3 demonstrates activity for 20-30 hours, making it particularly valuable for extended laboratory investigations.

Recombinant IGF-1 LR3 is available as a lyophilized powder that requires reconstitution before use in laboratory research. Scientists who buy IGF-1 LR3 online typically use it to study growth factor signaling pathways and related cellular mechanisms in controlled laboratory environments.

Research Applications of IGF-1 LR3

When scientists buy IGF-1 LR3 online, they typically focus on several key research areas. This peptide has been extensively studied in laboratory settings for its potential applications in various experimental models:

Cellular Growth Pathway Research

IGF-1 LR3 has been investigated for its effects on cellular growth and proliferation mechanisms in laboratory settings. Research suggests that when IGF-1 LR3 binds to IGF-1 receptors on cell surfaces, it may initiate a cascade of intracellular signaling events, primarily through the PI3K/Akt and MAPK pathways. These events have been studied for their role in stimulating protein synthesis and cell division. Scientists who buy IGF-1 LR3 online often examine these pathways using various in vitro and in vivo experimental models.

Muscle Tissue Research Models

Another area where researchers buy IGF-1 LR3 online is for muscle tissue studies. Laboratory investigations have explored how IGF-1 LR3 interacts with skeletal muscle cells in experimental models. These studies typically examine parameters such as protein synthesis rates, satellite cell activation, and myoblast differentiation under controlled conditions. The peptide’s ability to potentially promote both hyperplasia (increase in cell number) and hypertrophy (increase in cell size) makes it particularly interesting for muscle biology research.

Metabolic Signaling Studies

IGF-1 LR3 has been studied for its interaction with metabolic processes in research settings. Researchers who buy IGF-1 LR3 online may investigate its effects on glucose metabolism, insulin sensitivity, and lipid utilization in laboratory models. These studies contribute to the broader understanding of how growth factors influence metabolic regulation and energy homeostasis.

Endocrine System Experiments

The peptide has been examined in various endocrine system research models. Scientists who buy IGF-1 LR3 online often study its interactions with other hormonal systems, including growth hormone and insulin pathways. These investigations help elucidate the complex interplay between different endocrine signals in controlled laboratory settings.

Receptor Binding Studies

When researchers buy IGF-1 LR3 online, they frequently use it to study IGF-1 receptor binding characteristics. The peptide has been investigated for its affinity, specificity, and kinetics of interaction with IGF-1 receptors. These studies contribute to the fundamental understanding of structure-activity relationships in growth factor peptides and their receptors.

IGF-1 LR3 Mechanism of Action in Research Settings

Scientists who buy IGF-1 LR3 online are often interested in its mechanism of action, which has been extensively studied in laboratory settings. Research suggests that IGF-1 LR3 primarily works by binding to IGF-1 receptors, which are tyrosine kinase receptors present on the surface of many cell types.

When IGF-1 LR3 binds to IGF-1 receptors in experimental models, it appears to trigger a conformational change in the receptor, leading to autophosphorylation of the receptor’s intracellular domain. This initiates two main signaling cascades: the phosphatidylinositol 3-kinase (PI3K)/Akt pathway and the Ras/mitogen-activated protein kinase (MAPK) pathway.

Research has shown that in laboratory settings, the PI3K/Akt pathway may play a crucial role in protein synthesis, glucose uptake, and cell survival, while the MAPK pathway has been studied for its potential involvement in cell proliferation and differentiation. These dual signaling mechanisms make IGF-1 LR3 a valuable tool for studying complex cellular responses.

Scientists who buy IGF-1 LR3 online for research purposes have also investigated its reduced binding to IGF binding proteins (IGFBPs). Studies suggest that the structural modifications in IGF-1 LR3 significantly decrease its affinity for IGFBPs, potentially allowing more free peptide to interact with receptors and extending its biological activity in experimental models.

Product Specifications: Premium IGF-1 LR3 for Sale

When you buy IGF-1 LR3 online from Anabolic Steroid Shop, you’re purchasing a research peptide that meets rigorous quality standards:

Available Strengths

IGF-1 LR3 0.1mg: Our standard research-grade vial containing 0.1mg of lyophilized IGF-1 LR3 peptide
IGF-1 LR3 1mg: Higher concentration vial containing 1mg of lyophilized IGF-1 LR3 peptide

Product Details

Purity: >98% (verified by HPLC analysis)
Form: Lyophilized powder in sealed glass vials
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular Formula: C₃₈₁H₆₂₂N₁₁₄O₁₁₅S₆
Molecular Weight: Approximately 9,111 daltons
CAS Number: 946870-92-4
Production Method: Recombinant DNA technology in E. coli
Batch Testing: Each production batch undergoes comprehensive quality control testing
Documentation: Certificate of Analysis (COA) available for verification

Quality Assurance

When you buy IGF-1 LR3 online from us, you benefit from our commitment to quality:

Third-Party Testing: Independent laboratory verification of purity and identity
Consistent Manufacturing: Standardized production protocols ensure batch-to-batch consistency
Sterile Processing: Manufactured in controlled environments to prevent contamination
Sealed Packaging: Tamper-evident vials protect product integrity

Why Buy IGF-1 LR3 Online From Anabolic Steroid Shop?

When researchers choose to buy IGF-1 LR3 online from Anabolic Steroid Shop, they gain several advantages:

Superior Product Quality

Our IGF-1 LR3 peptide for sale undergoes rigorous quality control measures:

Pharmaceutical-Grade Manufacturing: Produced using advanced recombinant DNA technology
High Purity Standards: Minimum 98% purity guaranteed for research applications
Comprehensive Testing: Multiple analytical methods verify peptide identity and purity
Quality Documentation: Detailed Certificate of Analysis provided with every purchase

Research-Focused Supplier

As specialists in research peptides, we understand the importance of reliable products:

Scientific Expertise: Our team includes professionals with extensive knowledge of peptide chemistry
Research Community Focus: Products designed specifically for laboratory research applications
Technical Support: Access to knowledgeable staff who can address product-specific questions
Educational Resources: Comprehensive information about peptide handling and storage

Customer Satisfaction

When you buy IGF-1 LR3 online from us, you benefit from our customer-centric approach:

Responsive Service: Quick resolution of inquiries and concerns
Secure Transactions: Protected payment processing systems
Discreet Packaging: Professional, unmarked packaging protects your privacy
Fast Shipping: Efficient delivery to domestic and international research facilities
Satisfaction Guarantee: Commitment to resolving any product quality issues

Limited Availability

Our premium IGF-1 LR3 peptide for sale is produced in controlled batch quantities:

Small-Batch Production: Limited manufacturing runs ensure freshness and quality
High Demand Research Peptide: Popular among serious researchers
Secure Your Supply: Order now to ensure availability for your ongoing research

Storage & Handling Instructions for IGF-1 LR3

Proper storage and handling are essential when you buy IGF-1 LR3 online for research purposes:

Storage Recommendations

Lyophilized (Powder) Form:
- Store unopened vials at -20°C (freezer)
- Protect from light exposure
- Keep in original container with lid tightly sealed
- Avoid moisture contamination
Reconstituted Solution:
- Store at 2-8°C (refrigerator)
- Use within 14 days for optimal stability
- Avoid repeated freeze-thaw cycles
- Protect from direct light

Handling Precautions

Laboratory Environment: Handle under appropriate laboratory conditions
Sterile Technique: Use aseptic methods when reconstituting
Personal Protection: Wear appropriate laboratory safety equipment
Documentation: Maintain records of storage conditions and usage

Reconstitution Guidelines

When researchers buy IGF-1 LR3 online and prepare it for laboratory use:

Use bacteriostatic water or sterile acetic acid solution (0.1%)
Calculate concentration based on research protocols
Allow the vial to reach room temperature before reconstitution
Gently swirl to dissolve; avoid vigorous shaking
Document reconstitution date and calculated concentration

Frequently Asked Questions About IGF-1 LR3

What is IGF-1 LR3 used for in research?

IGF-1 LR3 is primarily used in laboratory research to study cellular growth and metabolic signaling pathways. Scientists who buy IGF-1 LR3 online typically investigate its interactions with the IGF-1 receptor and subsequent effects on protein synthesis, cell proliferation, and glucose metabolism. It’s also studied in muscle tissue research, metabolic regulation models, and various endocrine system pathways. All research with IGF-1 LR3 should be conducted in appropriate laboratory settings by qualified professionals.

How does IGF-1 LR3 differ from regular IGF-1?

IGF-1 LR3 features significant structural modifications compared to native IGF-1. Researchers who buy IGF-1 LR3 online often note three key differences: 1) It contains a 13-amino acid extension at the N-terminus, 2) It has an arginine substitution at position 3, and 3) These modifications dramatically reduce binding to IGF binding proteins. As a result, IGF-1 LR3 demonstrates a much longer half-life in research settings (20-30 hours versus 12-15 minutes for native IGF-1) and potentially greater potency, making it valuable for extended laboratory studies of IGF-1 signaling pathways.

Is IGF-1 LR3 legal to purchase?

Yes, it is legal to buy IGF-1 LR3 online for research purposes. IGF-1 LR3 peptide for sale is intended exclusively for laboratory research and is not approved for human consumption or veterinary use. Researchers should ensure compliance with local regulations regarding the purchase and use of research peptides. Always review our Terms and Conditions before purchasing.

How should IGF-1 LR3 be stored?

When you buy IGF-1 LR3 online, proper storage is essential for maintaining its stability. Lyophilized (powder) IGF-1 LR3 should be stored in a freezer at -20°C, protected from light and moisture. Once reconstituted, the solution should be kept refrigerated at 2-8°C and used within 14 days for optimal results. Avoid repeated freeze-thaw cycles as they can degrade the peptide’s structure and reduce its effectiveness in research applications.

Is your IGF-1 LR3 lab tested?

Absolutely. All researchers who buy IGF-1 LR3 online from Anabolic Steroid Shop receive products that undergo comprehensive laboratory testing. Each batch is analyzed using High-Performance Liquid Chromatography (HPLC) to verify purity (>98%) and Mass Spectrometry to confirm peptide identity. We provide a Certificate of Analysis (COA) with every purchase, allowing researchers to verify the quality and specifications of their IGF-1 LR3 peptide for sale.

What is the molecular weight of IGF-1 LR3?

IGF-1 LR3 has a molecular weight of approximately 9,111 daltons. This information is important for researchers who buy IGF-1 LR3 online and need to perform precise calculations for their experimental protocols. The peptide consists of 83 amino acids, including the 13-amino acid extension at the N-terminus and the arginine substitution at position 3, contributing to its molecular structure and weight.

How is IGF-1 LR3 typically reconstituted in research settings?

In laboratory settings, IGF-1 LR3 is typically reconstituted with bacteriostatic water or a sterile 0.1% acetic acid solution. Researchers who buy IGF-1 LR3 online should calculate the desired concentration based on their specific experimental protocols. The reconstitution process should be performed using aseptic technique, allowing the vial to reach room temperature before adding the diluent, and gently swirling to ensure complete dissolution without damaging the peptide structure.

What is the difference between IGF-1 LR3 0.1mg and IGF-1 LR3 1mg vials?

The difference is simply the amount of IGF-1 LR3 peptide contained in each vial. When you buy IGF-1 LR3 online, you can choose between 0.1mg or 1mg vials based on your research needs. The 0.1mg vial is suitable for smaller-scale experiments or when testing new protocols, while the 1mg vial offers better value for established research programs with higher volume requirements. Both contain the same high-purity IGF-1 LR3 peptide, just in different quantities.

How should IGF-1 LR3 be handled in the laboratory?

Researchers who buy IGF-1 LR3 online should handle it according to standard laboratory practices for peptides. This includes using appropriate personal protective equipment, working in a clean environment, employing aseptic technique during reconstitution, and maintaining proper documentation. The peptide should be handled carefully to avoid contamination, excessive agitation, or exposure to extreme temperatures that could affect its stability and research utility.

Where can I find high-quality IGF-1 LR3 for my research?

You can buy IGF-1 LR3 online from Anabolic Steroid Shop, a trusted supplier of research peptides. Our IGF-1 LR3 product page offers high-purity peptides in both 0.1mg and 1mg vials, complete with quality documentation and professional customer support. We also offer a range of other research peptides in our HGH & Peptides category.

Buy IGF-1 LR3 Online Today

Ready to advance your research with premium-quality IGF-1 LR3? When you buy IGF-1 LR3 online from Anabolic Steroid Shop, you’re choosing a research peptide supplier committed to quality, reliability, and customer satisfaction.

Our IGF-1 LR3 peptide for sale is manufactured to exacting standards, ensuring consistent results for your laboratory investigations. Each batch undergoes comprehensive testing to verify purity and identity, giving you confidence in your research materials.

Whether you need IGF-1 LR3 0.1mg or IGF-1 LR3 1mg vials, we offer flexible options to meet your research requirements. Our secure ordering process, discreet packaging, and efficient shipping ensure a smooth experience from purchase to delivery.

Don’t compromise on quality when you buy IGF-1 LR3 online. Choose Anabolic Steroid Shop, where research excellence meets exceptional service. Explore our complete selection of high-purity peptides in our HGH & Peptides category.

Buy IGF-1 LR3 online today from a trusted research peptide supplier and secure premium-grade quality for your laboratory needs.

Additional Research Information on IGF-1 LR3

IGF-1 LR3 in Scientific Literature

The scientific community continues to explore the properties and potential applications of IGF-1 LR3 in various research models. When you buy IGF-1 LR3 online for laboratory investigations, you’re working with a peptide that has been the subject of numerous scientific publications.

Studies have examined IGF-1 LR3’s interaction with the IGF-1 receptor and its effects on cellular growth and metabolism in various experimental settings. Research has also investigated its potential role in protein synthesis, glucose uptake, cell proliferation, and differentiation.

Scientists who buy IGF-1 LR3 online often cite its well-characterized receptor binding profile and consistent effects in laboratory models as advantages for research applications. The peptide’s enhanced stability and reduced binding to IGF binding proteins also make it suitable for various experimental protocols requiring extended exposure times.

Structural Characteristics of IGF-1 LR3

IGF-1 LR3 is an 83-amino acid polypeptide with a molecular weight of approximately 9,111 daltons. Researchers who buy IGF-1 LR3 online may be interested in its structural features that contribute to its enhanced properties:

The 13-amino acid N-terminal extension (MFPAMPLSSLFVN) increases stability and reduces binding to IGF binding proteins
The arginine substitution at position 3 (hence the “R3” designation) further modifies binding characteristics
The core IGF-1 sequence maintains the essential receptor binding domains
The tertiary structure includes three disulfide bridges that stabilize the three-dimensional conformation

These structural characteristics make IGF-1 LR3 a valuable tool for researchers studying growth factor signaling pathways and cellular responses to IGF-1 receptor activation.

Comparative Research Applications

Scientists who buy IGF-1 LR3 online often use it alongside native IGF-1 to conduct comparative studies. Such investigations may examine differences in receptor binding, signaling pathway activation, or cellular responses in laboratory models.

Comparative studies between IGF-1 LR3 and native IGF-1 help researchers understand the impact of binding protein interactions on growth factor activity. These investigations contribute to the broader understanding of IGF-1 regulation and related physiological processes.

Quality Commitment When You Buy IGF-1 LR3 Online

At Anabolic Steroid Shop, we understand that research success depends on reliable, high-quality materials. When you buy IGF-1 LR3 online from us, you benefit from our unwavering commitment to quality:

Rigorous Manufacturing Standards

Our IGF-1 LR3 peptide for sale is produced using advanced recombinant DNA technology that ensures high purity and consistent quality. The manufacturing process follows strict protocols to prevent contamination and maintain peptide integrity.

Comprehensive Quality Control

Each batch of IGF-1 LR3 undergoes multiple analytical tests to verify:

Peptide Identity: Mass spectrometry confirms the correct molecular structure
Purity Assessment: HPLC analysis verifies >98% purity
Sterility Testing: Ensures the absence of microbial contamination
Endotoxin Screening: Confirms the product is free from bacterial endotoxins

Documentation and Transparency

When you buy IGF-1 LR3 online from us, you receive complete documentation:

Certificate of Analysis: Detailed report of analytical test results
Batch Information: Specific production and expiration dates
Storage Guidelines: Clear instructions for maintaining peptide stability
Technical Support: Access to knowledgeable staff for product-specific questions

Continuous Improvement

We continuously refine our processes to enhance product quality:

Regular Supplier Audits: Ensure raw material quality meets our standards
Updated Testing Methods: Implement advanced analytical techniques
Customer Feedback Integration: Improve products based on researcher input
Industry Standard Monitoring: Stay current with best practices in peptide manufacturing

Buy IGF-1 LR3 Online: Ordering Information

Ready to purchase high-quality IGF-1 LR3 for your research? Here’s what you need to know:

Product Options

IGF-1 LR3 0.1mg: Ideal for smaller research projects or initial testing
IGF-1 LR3 1mg: Better value for established research programs

Ordering Process

Visit our IGF-1 LR3 product page
Select your preferred quantity
Add to cart and proceed to checkout
Complete the secure payment process
Receive order confirmation and tracking information

Shipping Information

Domestic Shipping: Fast delivery within the USA
International Shipping: Available to most research facilities worldwide
Discreet Packaging: Professional, unmarked packaging protects your privacy
Temperature Control: Appropriate packaging to maintain product stability during transit

Payment Options

Multiple secure payment methods available
Encrypted transaction processing
Discreet billing for your privacy

Customer Support

Our knowledgeable team is available to assist with:

Product-specific questions
Order status inquiries
Technical information requests
Post-purchase support

Conclusion: Why Researchers Buy IGF-1 LR3 Online From Us

When you buy IGF-1 LR3 online from Anabolic Steroid Shop, you’re choosing a partner committed to supporting your research success. Our high-purity IGF-1 LR3 peptide for sale meets the exacting standards required for meaningful scientific investigation.

From our rigorous quality control processes to our responsive customer service, every aspect of our operation is designed to provide researchers with reliable products and a seamless purchasing experience. Whether you’re studying cellular growth pathways, metabolic processes, or receptor signaling mechanisms, our IGF-1 LR3 provides the consistent quality you need.

Explore our complete selection of research peptides in our HGH & Peptides category and discover why leading researchers choose Anabolic Steroid Shop as their trusted supplier.